TA334818 C6orf136 antibody

Rabbit Polyclonal Anti-C6orf136 Antibody

See related secondary antibodies

Search for all "C6orf136"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat C6orf136

Product Description for C6orf136

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat C6orf136.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C6orf136

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5SQH8
Immunogen:
The immunogen for anti-C6orf136 antibody is: synthetic peptide directed towards the middle region of Human C6orf136. Synthetic peptide located within the following region: CPYPGAWIPFQVPGTAHPSPATPSGDPSMEEHLSVMYERLRQELPKLFLQ.
GeneID:
221545
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for C6orf136 (1 products)

Catalog No. Species Pres. Purity   Source  

C6orf136 (transcript variant 2)

C6orf136 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for C6orf136 (3 products)

Catalog No. Species Pres. Purity   Source  

C6orf136 Lysate

Western Blot: C6orf136 Lysate [NBL1-08515] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C6orf136 Protein
  Novus Biologicals Inc.

C6orf136 overexpression lysate

C6orf136 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

C6orf136 overexpression lysate

C6orf136 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn