TA334831 NATD1 antibody

Rabbit Polyclonal Anti-C17orf103 Antibody

See related secondary antibodies

Search for all "NATD1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Guinea Pig, Human, Mouse, Rat NATD1

Product Description for NATD1

Rabbit anti Bovine, Guinea Pig, Human, Mouse, Rat NATD1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NATD1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C17orf103, GTLF3B, N-acetyltransferase domain-containing protein 1
Presentation Purified
Reactivity Bov, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N6N6
Immunogen:
The immunogen for anti-C17orf103 antibody is: synthetic peptide directed towards the N-terminal region of Human C17orf103. Synthetic peptide located within the following region: EQGCPIRVEHDRRRRQFTVRLNGCHDRAVLLYEYVGKRIVDLQHTEVPDA.
GeneID:
256302
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NATD1 (3 products)

Catalog No. Species Pres. Purity   Source  

NATD1

NATD1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

NATD1 (1-113, His-tag)

NATD1 Human Purified > 95 % by SDS - PAGE E. coli
0.25 mg / €820.00
  OriGene Technologies GmbH

NATD1 (1-113, His-tag)

NATD1 Human Purified > 95 % by SDS - PAGE E. coli
50 µg / €320.00
  OriGene Technologies GmbH

Positive controls for NATD1 (2 products)

Catalog No. Species Pres. Purity   Source  

C17orf103 Lysate

Western Blot: C17orf103 Lysate [NBL1-13067] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C17orf103
  Novus Biologicals Inc.

NATD1 overexpression lysate

NATD1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn