TA334832 SERPINA11 antibody

Rabbit Polyclonal Anti-SERPINA11 Antibody

See related secondary antibodies

Search for all "SERPINA11"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat SERPINA11

Product Description for SERPINA11

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat SERPINA11.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SERPINA11

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Serpin A11
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86U17
Immunogen:
The immunogen for anti-SERPINA11 antibody is: synthetic peptide directed towards the middle region of Human SERPINA11. Synthetic peptide located within the following region: TFMVLANYIFFKAKWKHPFSRYQTQKQESFFVDERTSLQVPMMHQKEMHR.
GeneID:
256394
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SERPINA11 (1 products)

Catalog No. Species Pres. Purity   Source  

SERPINA11

SERPINA11 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for SERPINA11 (1 products)

Catalog No. Species Pres. Purity   Source  

SERPINA11 overexpression lysate

SERPINA11 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn