TA334840 SIAH3 antibody

Rabbit Polyclonal Anti-SIAH3 Antibody

See related secondary antibodies

Search for all "SIAH3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Human, Rabbit SIAH3

Product Description for SIAH3

Rabbit anti Canine, Equine, Human, Rabbit SIAH3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SIAH3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Seven in absentia homolog 3
Presentation Purified
Reactivity Can, Eq, Hu, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IW03
Immunogen:
The immunogen for anti-SIAH3 antibody is: synthetic peptide directed towards the N-terminal region of Human SIAH3. Synthetic peptide located within the following region: YVSSRRAVTQSAPEQGSFHPHHLSHHHCHHRHHHHLRHHAHPHHLHHQEA.
GeneID:
283514
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for SIAH3 (1 products)

Catalog No. Species Pres. Purity   Source  

SIAH3 overexpression lysate

SIAH3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn