TA334842 CCDC79 / TERB1 antibody

Rabbit Polyclonal Anti-CCDC79 Antibody

See related secondary antibodies

Search for all "CCDC79 / TERB1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human CCDC79 / TERB1

Product Description for CCDC79 / TERB1

Rabbit anti Canine, Human CCDC79 / TERB1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CCDC79 / TERB1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Coiled-coil domain-containing protein 79, Telomere repeats-binding bouquet formation protein 1
Presentation Purified
Reactivity Can, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NA31
Immunogen:
The immunogen for anti-CCDC79 antibody is: synthetic peptide directed towards the C-terminal region of Human CCDC79. Synthetic peptide located within the following region: ANPVHACYRESEQNKTLYKAKSSCNQNLHEETTFEKNFVSQSSDHVFKHP.
GeneID:
283847
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn