TA334846 C17orf89 antibody

Rabbit Polyclonal Anti-C17orf89 Antibody

See related secondary antibodies

Search for all "C17orf89"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human, Mouse, Rat C17orf89

Product Description for C17orf89

Rabbit anti Canine, Human, Mouse, Rat C17orf89.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C17orf89

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A1L188
Immunogen:
The immunogen for anti-C17orf89 antibody is: synthetic peptide directed towards the N-terminal region of Human C17orf89. Synthetic peptide located within the following region: VWGRVRSRLRAFPERLAACGAEAAAYGRCVQASTAPGGRLSKDFCAREFE.
GeneID:
284184
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for C17orf89 (1 products)

Catalog No. Species Pres. Purity   Source  

C17orf89 overexpression lysate

C17orf89 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn