TA334847 METRNL antibody

Rabbit Polyclonal Anti-METRNL Antibody

See related secondary antibodies

Search for all "METRNL"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Rat, Yeast METRNL

Product Description for METRNL

Rabbit anti Bovine, Equine, Guinea Pig, Human, Rat, Yeast METRNL.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for METRNL

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Meteorin-like protein, Subfatin
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Rt, Ye
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q641Q3
Immunogen:
The immunogen for anti-METRNL antibody is: synthetic peptide directed towards the C-terminal region of Human METRNL. Synthetic peptide located within the following region: GVRPGHGDFLFTGHMHFGEARLGCAPRFKDFQRMYRDAQERGLNPCEVGT.
GeneID:
284207
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn