TA334849 SIGLEC family-like protein 1 antibody

Rabbit Polyclonal Anti-SIGLECL1 Antibody

See related secondary antibodies

Search for all "SIGLEC family-like protein 1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Yeast SIGLEC family-like protein 1

Product Description for SIGLEC family-like protein 1

Rabbit anti Human, Yeast SIGLEC family-like protein 1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SIGLEC family-like protein 1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C19orf75, SIGLECL1
Presentation Purified
Reactivity Hu, Ye
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N7X8
Immunogen:
The immunogen for anti-SIGLECL1 antibody is: synthetic peptide directed towards the C-terminal region of Human SIGLECL1. Synthetic peptide located within the following region: RKKQAKKAAAIRAKKSSKVRASQELEMSLKPEEPGKPVVATFSESRILEK.
GeneID:
284369
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SIGLEC family-like protein 1 (1 products)

Catalog No. Species Pres. Purity   Source  

SIGLEC family-like protein 1

SIGLEC family-like protein 1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for SIGLEC family-like protein 1 (1 products)

Catalog No. Species Pres. Purity   Source  

SIGLECL1 overexpression lysate

SIGLECL1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn