TA334853 TREML4 antibody

Rabbit Polyclonal Anti-TREML4 Antibody

See related secondary antibodies

Search for all "TREML4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human TREML4

Product Description for TREML4

Rabbit anti Human TREML4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TREML4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms TLT4, Trem-like transcript 4 protein, Triggering receptor expressed on myeloid cells-like protein 4
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6UXN2
Immunogen:
The immunogen for anti-TREML4 antibody is: synthetic peptide directed towards the C-terminal region of Human TREML4. Synthetic peptide located within the following region: LPWLPTSTVLITSPEGTSGHPSINGSETRKSRAPACLGSGGPRFLVLVLC.
GeneID:
285852
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for TREML4 (1 products)

Catalog No. Species Pres. Purity   Source  

TREML4 overexpression lysate

TREML4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn