TA334862 SLC35F4 antibody

Rabbit Polyclonal Anti-SLC35F4 Antibody

See related secondary antibodies

Search for all "SLC35F4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat SLC35F4

Product Description for SLC35F4

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat SLC35F4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC35F4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C14orf36, Solute carrier family 35 member F4
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A4IF30
Immunogen:
The immunogen for anti-SLC35F4 antibody is: synthetic peptide directed towards the C-terminal region of Human SLC35F4. Synthetic peptide located within the following region: LLMLLPEEWDEITLRFINSLKEKKSEEHVDDVTDPSIHLRGRGRANGTVS.
GeneID:
341880
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn