TA334881 SLC22A25 antibody

Rabbit Polyclonal Anti-SLC22A25 Antibody

See related secondary antibodies

Search for all "SLC22A25"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat SLC22A25

Product Description for SLC22A25

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat SLC22A25.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC22A25

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Organic anion transporter UST6, Solute carrier family 22 member 25, UST6
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6T423
Immunogen:
The immunogen for anti-SLC22A25 antibody is: synthetic peptide directed towards the middle region of Human SLC22A25. Synthetic peptide located within the following region: VFFLFSRWLAESARWLIINNKPEEGLKELRKAAHRNGMKNAEDILTMEVL.
GeneID:
387601
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn