TA334884 TEX36 antibody

Rabbit Polyclonal Anti-TEX36 Antibody

See related secondary antibodies

Search for all "TEX36"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat TEX36

Product Description for TEX36

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat TEX36.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TEX36

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C10orf122, Testis-expressed sequence 36 protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5VZQ5
Immunogen:
The immunogen for anti-TEX36 antibody is synthetic peptide directed towards the middle region of Human TEX36. Synthetic peptide located within the following region: GRKKISPDKRQHVSRNFNLWACDYVPSCLDGFSNNQISYVYKEAMVVSSF.
GeneID:
387718
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for TEX36 (1 products)

Catalog No. Species Pres. Purity   Source  

TEX36 overexpression lysate

TEX36 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn