TA334885 VSTM5 antibody

Rabbit Polyclonal Anti-VSTM5 Antibody

See related secondary antibodies

Search for all "VSTM5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat VSTM5

Product Description for VSTM5

Rabbit anti Bovine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat VSTM5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for VSTM5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C11orf90, V-set and transmembrane domain-containing protein 5
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A8MXK1
Immunogen:
The immunogen for anti-VSTM5 antibody is: synthetic peptide directed towards the C-terminal region of Human VSTM5. Synthetic peptide located within the following region: HFVAVILAFLAAVAAVLISLMWVCNKCAYKFQRKRRHKLKESTTEEIELE.
GeneID:
387804
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for VSTM5 (1 products)

Catalog No. Species Pres. Purity   Source  

VSTM5 overexpression lysate

VSTM5 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn