TA334909 C17orf102 antibody

Rabbit Polyclonal Anti-C17orf102 Antibody

See related secondary antibodies

Search for all "C17orf102"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Rabbit C17orf102

Product Description for C17orf102

Rabbit anti Human, Rabbit C17orf102.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C17orf102

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Hu, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A2RUQ5
Immunogen:
The immunogen for anti-C17orf102 antibody is: synthetic peptide directed towards the middle region of Human C17orf102. Synthetic peptide located within the following region: FCSRSSRGAGRGHPTPTPRVRWALAGNQPRCCAQLLSGRGGSGAQLRAGW.
GeneID:
400591
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for C17orf102 (1 products)

Catalog No. Species Pres. Purity   Source  

C17orf102 overexpression lysate

C17orf102 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn