TA334914 XKRX antibody

Rabbit Polyclonal Anti-XKRX Antibody

See related secondary antibodies

Search for all "XKRX"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rat XKRX

Product Description for XKRX

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rat XKRX.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for XKRX

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Membrane protein XPLAC, X Kell blood group-related, X-linked, XK-related protein 2, XKR2, XPLAC, XRG2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6PP77
Immunogen:
The immunogen for anti-XKRX antibody is synthetic peptide directed towards the N-terminal region of Human XKRX. Synthetic peptide located within the following region: FVHRDLAKDKPLSLFMHLILLGPVIRCLEAMIKYLTLWKKEEQEEPYVSL.
GeneID:
402415
Application WB
Background This gene encodes a protein that is related to a component of the XK/Kell complex of the Kell blood group system. The encoded protein includes several transmembrane domains, is known to be exposed to the cell surface, and may function as a membrane transporter.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn