TA334915 ZBTB34 antibody

Rabbit Polyclonal Anti-ZBTB34 Antibody

See related secondary antibodies

Search for all "ZBTB34"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat ZBTB34

Product Description for ZBTB34

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat ZBTB34.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZBTB34

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1993, Zinc finger and BTB domain-containing protein 34
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NCN2
Immunogen:
The immunogen for anti-ZBTB34 antibody is: synthetic peptide directed towards the C-terminal region of Human ZBTB34. Synthetic peptide located within the following region: HPGVAEVRSRIESPERTDVYVEQKLENDASASEMGLDSRMEIHTVSDAPD.
GeneID:
403341
Application WB
Background ZBTB34 may be a transcriptiol repressor.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn