TA334922 TXLNG antibody

Rabbit Polyclonal Anti-TXLNG Antibody

See related secondary antibodies

Search for all "TXLNG"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat TXLNG

Product Description for TXLNG

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat TXLNG.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TXLNG

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CXorf15, ELRG, Environmental lipopolysaccharide-responding gene protein, FIAT, Factor inhibiting ATF4-mediated transcription, Gamma-taxilin, LSR5, Lipopolysaccharide-specific response protein 5
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NUQ3
Immunogen:
The immunogen for anti-TXLNG antibody is: synthetic peptide directed towards the N-terminal region of Human TXLNG. Synthetic peptide located within the following region: KADMLCNSQSNDILQHQGSNCGGTSNKHSLEEDEGSDFITENRNLVSPAY.
GeneID:
55787
Application WB
Background This gene encodes a member of the taxilin family. The encoded protein binds to the C-termil coiled-coil region of syntaxin family members 1A, 3A and 4A, and may play a role in intracellular vesicle trafficking. This gene is up-regulated by lipopolysaccharide and the gene product may be involved in cell cycle regulation. The related mouse protein was also shown to inhibit activating transcription factor 4-mediated transcription and thus regulate bone mass accrual. Altertively spliced transcript variants encoding different isoforms have been found for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for TXLNG (1 products)

Catalog No. Species Pres. Purity   Source  

TXLNG overexpression lysate

TXLNG overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn