TA334926 Transgelin-3 (TAGLN3) (N-term) antibody

Rabbit Polyclonal Anti-Tagln3 Antibody

See related secondary antibodies

Search for all "Transgelin-3 (TAGLN3)"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse Transgelin-3 (TAGLN3)

Product Description for Transgelin-3 (TAGLN3)

Rabbit anti Human, Mouse Transgelin-3 (TAGLN3).
Properties: (N-term)
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Transgelin-3 (TAGLN3)

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Neuronal protein NP22, Neuronal protein NP25
Presentation Aff - Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight Tagln3: 22 kDa
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9R1Q8
Immunogen:
Synthetic peptide directed towards the N-terminal region of mouse Tagln3
AA Sequence:
WLMDGTVLCKLINSLYPPGQEPIPKISESKMAFKQMEQISQFLKAAEVYG
GeneID:
56370
Property N-term
Application Western blotting (1 µg/ml).
General Readings Ito M, Depaz I, Wilce P, et al. (2005). "Expression of human neuronal protein 22, a novel cytoskeleton-associated protein, was decreased in the anterior cingulate cortex of schizophrenia". Neurosci. Lett. 378 (3): 125–30.
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Mouse, human.

Accessory Products

  • LinkedIn