TA334935 CENP-W antibody

Rabbit Polyclonal Anti-CENPW Antibody

See related secondary antibodies

Search for all "CENP-W"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Guinea Pig, Human CENP-W

Product Description for CENP-W

Rabbit anti Equine, Guinea Pig, Human CENP-W.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CENP-W

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C6orf173, CENPW, CUG2, Cancer-up-regulated gene 2 protein, Centromere protein W
Presentation Purified
Reactivity Eq, GP, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5EE01
Immunogen:
The immunogen for anti-CENPW antibody: synthetic peptide directed towards the N terminal of human CENPW. Synthetic peptide located within the following region: ALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFV.
GeneID:
387103
Application WB
Background CENPW is up-regulated in many cancer tissues. It suggests that CENPW may act as an oncogene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CENP-W (1 products)

Catalog No. Species Pres. Purity   Source  

CENP-W

CENP-W Human
  Abnova Taiwan Corp.

Positive controls for CENP-W (1 products)

Catalog No. Species Pres. Purity   Source  

CENPW overexpression lysate

CENPW overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn