TA334938 TCTEX1D4 antibody

Rabbit Polyclonal Anti-TCTEX1D4 Antibody

See related secondary antibodies

Search for all "TCTEX1D4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat TCTEX1D4

Product Description for TCTEX1D4

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat TCTEX1D4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TCTEX1D4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms RP11-269F19.9, Tctex-2-beta, Tctex1 domain-containing protein 4
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5JR98
Immunogen:
The immunogen for anti-TCTEX1D4 antibody: synthetic peptide directed towards the N terminal of human TCTEX1D4. Synthetic peptide located within the following region: RGSMLGLAASFSRRNSLVGPGAGPGGQRPSLGPVPPLGSRVSFSGLPLAP.
GeneID:
343521
Application WB
Background TCTEX1D4 (also known as TCTEX1D4) belongs to the dynein light chain Tctex-type family. The exact function of TCTEX1D4 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn