TA334943 EXOC7 antibody

Rabbit Polyclonal Anti-EXOC7 Antibody

See related secondary antibodies

Search for all "EXOC7"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rat EXOC7

Product Description for EXOC7

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rat EXOC7.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for EXOC7

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms EXO70, Exocyst complex component 7, Exocyst complex component Exo70, KIAA1067
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UPT5
Immunogen:
The immunogen for anti-EXOC7 antibody is: synthetic peptide directed towards the C-terminal region of Human EXOC7. Synthetic peptide located within the following region: FLHNNYNYILKSLEKSELIQLVAVTQKTAERSYREHIEQQIQTYQRSWLK.
GeneID:
23265
Application WB
Background The protein encoded by this gene is a component of the exocyst complex. The exocyst complex plays a critical role in vesicular trafficking and the secretory pathway by targeting post-Golgi vesicles to the plasma membrane. The encoded protein is required for assembly of the exocyst complex and docking of the complex to the plasma membrane. The encoded protein may also play a role in pre-mR splicing through interactions with pre-mR-processing factor 19. Altertively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 4.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for EXOC7 (4 products)

Catalog No. Species Pres. Purity   Source  

EXOC7 (transcript variant 2)

EXOC7 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

EXOC7 (transcript variant 6)

EXOC7 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

EXOC7

EXOC7 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

EXOC7

EXOC7 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn