TA334944 Annexin A2 receptor / ANXA2R antibody

Rabbit Polyclonal Anti-ANXA2R Antibody

See related secondary antibodies

Search for all "Annexin A2 receptor / ANXA2R"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human Annexin A2 receptor / ANXA2R

Product Description for Annexin A2 receptor / ANXA2R

Rabbit anti Human Annexin A2 receptor / ANXA2R.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Annexin A2 receptor / ANXA2R

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms AX2R, AXIIR, Annexin II receptor, Annexin-2 receptor, C5orf39
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q3ZCQ2
Immunogen:
Synthetic peptide directed towards the N terminal of human ANXA2R
AA Sequence:
EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS
GeneID:
389289
Application

Western blotting  (0.2 - 1 µg/ml).

Background ANXA2R may act as a receptor for annexin II on marrow stromal cells to induce osteoclast formation. It is highly expressed in lymphocytes and expressed in both resting CD4+ and CD8+ T-cells.
General Readings "Cloning and characterization of the annexin II receptor on human marrow stromal cells." Lu G., Maeda H., Reddy S.V., Kurihara N., Leach R., Anderson J.L., Roodman G.D. J. Biol. Chem. 281:30542-30550(2006)
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human.

Accessory Products

Proteins and/or Positive Controls

Proteins for Annexin A2 receptor / ANXA2R (2 products)

Catalog No. Species Pres. Purity   Source  

Annexin A2 receptor / ANXA2R

Annexin A2 receptor / ANXA2R Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Annexin A2 receptor / ANXA2R

Annexin A2 receptor / ANXA2R Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Annexin A2 receptor / ANXA2R (3 products)

Catalog No. Species Pres. Purity   Source  

ANXA2R overexpression lysate

ANXA2R overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

AX2R 293T Cell Transient Overexpression Lysate(Denatured)

AX2R 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

AX2R Lysate

Western Blot: C5orf39 Lysate [NBL1-08496] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C5orf39 Protein
  Novus Biologicals Inc.
  • LinkedIn