TA334958 ARHGAP30 antibody

Rabbit Polyclonal Anti-ARHGAP30 Antibody

See related secondary antibodies

Search for all "ARHGAP30"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat ARHGAP30

Product Description for ARHGAP30

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat ARHGAP30.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ARHGAP30

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Rho GTPase-activating protein 30, Rho-type GTPase-activating protein 30
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7Z6I6
Immunogen:
The immunogen for anti-ARHGAP30 antibody: synthetic peptide directed towards the N terminal of human ARHGAP30. Synthetic peptide located within the following region: RKWRSIFNLGRSGHETKRKLPRGAEDREDKSNKGTLRPAKSMDSLSAAAG.
GeneID:
257106
Application WB
Background ARHGAP30 is a GTPase activator for the Rho-type GTPases by converting them to an ictive GDP-bound state.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn