TA334963 SUN3 antibody

Rabbit Polyclonal Anti-SUN3 Antibody

See related secondary antibodies

Search for all "SUN3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Rabbit, Rat, Zebrafish SUN3

Product Description for SUN3

Rabbit anti Bovine, Canine, Human, Mouse, Rabbit, Rat, Zebrafish SUN3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SUN3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms SUN domain-containing protein 3, SUNC1, Sad1/unc-84 domain-containing protein 1
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TAQ9
Immunogen:
The immunogen for anti-SUN3 antibody: synthetic peptide directed towards the C terminal of human SUN3. Synthetic peptide located within the following region: IKLATKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGITKKCEGEEIFL.
GeneID:
256979
Application WB
Background SUN3 is a single-pass membrane protein. It contains 1 Unc84 (SUN) domain.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SUN3 (2 products)

Catalog No. Species Pres. Purity   Source  

SUN3 (transcript variant 2)

SUN3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

SUN3 (transcript variant 1)

SUN3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for SUN3 (4 products)

Catalog No. Species Pres. Purity   Source  

SUN3 overexpression lysate

SUN3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

SUN3 overexpression lysate

SUN3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

SUN3 overexpression lysate

SUN3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

SUNC1 Lysate

Western Blot: SUNC1 Lysate [NBL1-16614] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SUN3
  Novus Biologicals Inc.
  • LinkedIn