TA334967 C17orf104 antibody

Rabbit Polyclonal Anti-C17orf104 Antibody

See related secondary antibodies

Search for all "C17orf104"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat C17orf104

Product Description for C17orf104

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat C17orf104.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C17orf104

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms FLJ35848
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A2RUB1
Immunogen:
The immunogen for anti-C17orf104 antibody: synthetic peptide directed towards the C terminal of human C17orf104. Synthetic peptide located within the following region: LHIRLEECCEQWRALEKERKKTELALAKNYPGKKVSSTNNTPVPRLTSNP.
GeneID:
284071
Application WB
Background The specific function of C17orf104 is not yet known.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn