TA334975 MPEG1 antibody

Rabbit Polyclonal Anti-MPEG1 Antibody

See related secondary antibodies

Search for all "MPEG1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human MPEG1

Product Description for MPEG1

Rabbit anti Human MPEG1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MPEG1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Macrophage gene 1 protein, Macrophage-expressed gene 1 protein, Mpg-1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q2M385
Immunogen:
The immunogen for anti-MPEG1 antibody: synthetic peptide directed towards the middle region of human MPEG1. Synthetic peptide located within the following region: TILAVVITLAIYGTRKFKKKAYQAIEERQSLVPGTAATGDTTYQEQGQSP.
GeneID:
219972
Application WB
Background The specific function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MPEG1 (1 products)

Catalog No. Species Pres. Purity   Source  

MPEG1

MPEG1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for MPEG1 (1 products)

Catalog No. Species Pres. Purity   Source  

MPEG1 overexpression lysate

MPEG1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn