TA334985 TRAK1 antibody

Rabbit Polyclonal Anti-TRAK1 Antibody

See related secondary antibodies

Search for all "TRAK1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat TRAK1

Product Description for TRAK1

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat TRAK1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TRAK1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 106 kDa O-GlcNAc transferase-interacting protein, KIAA1042, OIP106, Trafficking kinesin-binding protein 1
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UPV9
Immunogen:
The immunogen for anti-TRAK1 antibody: synthetic peptide directed towards the middle region of human TRAK1. Synthetic peptide located within the following region: IYGYDHDDWLHTPLISPDANIDLTTEQIEETLKYFLLCAERVGQMTKTYN.
GeneID:
22906
Application WB
Background The specific function of the protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TRAK1 (3 products)

Catalog No. Species Pres. Purity   Source  

TRAK1 (transcript variant 2)

TRAK1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

TRAK1

TRAK1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TRAK1

TRAK1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for TRAK1 (1 products)

Catalog No. Species Pres. Purity   Source  

OIP106 Lysate

Western Blot: OIP106 Lysate [NBL1-17251] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TRAK1
  Novus Biologicals Inc.
  • LinkedIn