TA334987 FGR / SRC2 antibody

Rabbit Polyclonal Anti-FGR Antibody

See related secondary antibodies

Search for all "FGR / SRC2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat FGR / SRC2

Product Description for FGR / SRC2

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat FGR / SRC2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FGR / SRC2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C-FGR, Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog, P55-FGR, Proto-oncogene tyrosine-protein kinase FGR
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P09769
Immunogen:
The immunogen for anti-FGR antibody: synthetic peptide directed towards the middle region of human FGR. Synthetic peptide located within the following region: CPPGCPASLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQ.
GeneID:
2268
Application WB
Background This gene is a member of the Src family of protein tyrosine kises (PTKs). The encoded protein contains N-termil sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to plasma membrane ruffles, and functions as a negative regulator of cell migration and adhesion triggered by the beta-2 integrin sigl transduction pathway. Infection with Epstein-Barr virus results in the overexpression of this gene. Multiple altertively spliced variants, encoding the same protein, have been identified.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FGR / SRC2 (8 products)

Catalog No. Species Pres. Purity   Source  

FGR / SRC2 (transcript variant 1)

FGR / SRC2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

FGR / SRC2

FGR / SRC2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

FGR / SRC2

FGR / SRC2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

FGR / SRC2

FGR / SRC2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

FGR / SRC2

FGR / SRC2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

FGR / SRC2

FGR / SRC2 Human
  Abnova Taiwan Corp.

FGR / SRC2

FGR / SRC2 Human
  Abnova Taiwan Corp.

FGR / SRC2

FGR / SRC2 Human
  Abnova Taiwan Corp.

Positive controls for FGR / SRC2 (5 products)

Catalog No. Species Pres. Purity   Source  

FGR 293T Cell Transient Overexpression Lysate(Denatured)

FGR 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

FGR Lysate

Western Blot: FGR Lysate [NBL1-10712] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for FGR
  Novus Biologicals Inc.

FGR overexpression lysate

FGR overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

FGR overexpression lysate

FGR overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

FGR overexpression lysate

FGR overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn