TA334993 PELI3 antibody

Rabbit Polyclonal Anti-PELI3 Antibody

See related secondary antibodies

Search for all "PELI3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rat PELI3

Product Description for PELI3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rat PELI3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PELI3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Pellino 3, Pellino-3, Protein pellino homolog 3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N2H9-2
Immunogen:
The immunogen for anti-PELI3 antibody: synthetic peptide directed towards the N terminal of human PELI3. Synthetic peptide located within the following region: VLEGNPEVGSPRTSDLQHRGNKGSCVLSSPGEDAQPGEEPIKYGELIVLG.
GeneID:
246330
Application WB
Background Toll-like receptors (TLRs) and IL1R (IL1R1) are part of the inte immune response aimed at mobilizing defense mechanisms in response in infection or injury. Pellino proteins, such as PELI3, are intermediate components in the sigling cascades initiated by TLRs and IL1R.Toll-like receptors (TLRs; see MIM 603030) and IL1R (IL1R1; MIM 147810) are part of the inte immune response aimed at mobilizing defense mechanisms in response in infection or injury. Pellino proteins, such as PELI3, are intermediate components in the sigling cascades initiated by TLRs and IL1R (Jensen and Whitehead, 2003 [PubMed 12874243]).[supplied by OMIM].
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn