TA335000 UBE4B antibody

Rabbit Polyclonal Anti-UBE4B Antibody

See related secondary antibodies

Search for all "UBE4B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human, Porcine UBE4B

Product Description for UBE4B

Rabbit anti Canine, Human, Porcine UBE4B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for UBE4B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HDNB1, Homozygously deleted in neuroblastoma 1, KIAA0684, UFD2, Ubiquitin conjugation factor E4 B, Ubiquitin fusion degradation protein 2
Presentation Purified
Reactivity Can, Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O95155
Immunogen:
The immunogen for anti-UBE4B antibody: synthetic peptide directed towards the N terminal of human UBE4B. Synthetic peptide located within the following region: SPMFCSVASFGASSLSSLYESSPAPTPSFWSSVPVMGPSLASPSRAASQL.
GeneID:
10277
Application WB
Background The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitition involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE4B is an additiol conjugation factor, E4, which is involved in multiubiquitin chain assembly. The gene that encodes the protein is also the strongest candidate in the neuroblastoma tumor suppressor genes. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitition involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes an additiol conjugation factor, E4, which is involved in multiubiquitin chain assembly. This gene is also the strongest candidate in the neuroblastoma tumor suppressor genes. Altertively spliced transcript variants encoding distinct isoforms have been found for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for UBE4B (3 products)

Catalog No. Species Pres. Purity   Source  

UBE4B

UBE4B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

UBE4B

UBE4B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

UBE4B

UBE4B Human
  Abnova Taiwan Corp.
  • LinkedIn