TA335004 Arginase-2 antibody

Rabbit Polyclonal Anti-ARG2 Antibody

See related secondary antibodies

Search for all "Arginase-2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat Arginase-2

TA335004

More Views

  • TA335004

Product Description for Arginase-2

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat Arginase-2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Arginase-2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ARG2, Arginase II, Arginase-2 mitochondrial, Kidney-type arginase, Non-hepatic arginase
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P78540
Immunogen:
The immunogen for anti-ARG2 antibody: synthetic peptide directed towards the C terminal of human ARG2. Synthetic peptide located within the following region: SALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPT.
GeneID:
384
Application WB
Background Argise catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian argise exists (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. ARG2 (type II isoform) is located in the mitochondria and expressed in extra-hepatic tissues, especially kidney. The physiologic role of this isoform is poorly understood; it is thought to play a role in nitric oxide and polyamine metabolism.Argise catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian argise exists (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. The type II isoform encoded by this gene, is located in the mitochondria and expressed in extra-hepatic tissues, especially kidney. The physiologic role of this isoform is poorly understood; it is thought to play a role in nitric oxide and polyamine metabolism. Transcript variants of the type II gene resulting from the use of altertive polyadenylation sites have been described. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Arginase-2 (7 products)

Catalog No. Species Pres. Purity   Source  

Arginase-2

Arginase-2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Arginase-2 (23-354, His-tag)

Recombinant human ARG2, 23-354aa, His-tagged Human Purified > 95 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

Arginase-2 (23-354, His-tag)

Recombinant human ARG2, 23-354aa, His-tagged Human Purified > 95 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH

Arginase-2

Arginase-2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Arginase-2

Arginase-2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Arginase-2

Arginase-2 Human Purified
  Novus Biologicals Inc.

Arginase-2

Arginase-2 Human Purified
  Novus Biologicals Inc.

Positive controls for Arginase-2 (2 products)

Catalog No. Species Pres. Purity   Source  

ARG2 Lysate

Western Blot: ARG2 Lysate [NBL1-07663] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ARG2 Protein
  Novus Biologicals Inc.

Arginase-2 Lysate(Denatured)

Arginase-2 Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn