TA335026 FGF9 antibody

Rabbit Polyclonal Anti-Fgf9 Antibody

See related secondary antibodies

Search for all "FGF9"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat FGF9

Product Description for FGF9

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat FGF9.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FGF9

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Fibroblast growth factor 9, GAF, Glia-activating factor, HBGF9, Heparin-binding growth factor 9
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P54130
Immunogen:
The immunogen for anti-Fgf9 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Fgf9. Synthetic peptide located within the following region: AVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFIS.
GeneID:
14180
Application WB
Background Fgf9 plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. May have a role in glial cell growth and differentiation during development, gliosis during repair and regeneration of brain tissue after damage, differentiation and survival of neurol cells, and growth stimulation of glial tumors.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FGF9 (5 products)

Catalog No. Species Pres. Purity   Source  

FGF9

FGF9 Mouse > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
10 µg / €230.00
  OriGene Technologies, Inc.

FGF9

FGF9 Mouse Purified > 95 % pure by SDS-PAGE and HPLC analyses E. coli
  OriGene Technologies GmbH

FGF9

FGF9 Mouse Purified > 95 % pure by SDS-PAGE and HPLC analyses E. coli
  OriGene Technologies GmbH

FGF9

FGF9 Mouse
  Abnova Taiwan Corp.

FGF9

FGF9 Mouse
  Abnova Taiwan Corp.
  • LinkedIn