TA335036 G protein alpha inhibitor 1 antibody

Rabbit Polyclonal Anti-GNAI1 Antibody

See related secondary antibodies

Search for all "G protein alpha inhibitor 1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Yeast G protein alpha inhibitor 1

TA335036

More Views

  • TA335036
  • TA335036

Product Description for G protein alpha inhibitor 1

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Yeast G protein alpha inhibitor 1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for G protein alpha inhibitor 1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GNAI1, Guanine nucleotide-binding protein G(i) alpha-1 subunit
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Por, Rb, Rt, Ye
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P63096
Immunogen:
The immunogen for anti-GNAI1 antibody: synthetic peptide directed towards the middle region of human GNAI1. Synthetic peptide located within the following region: YQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLH.
GeneID:
2770
Application WB
Background Guanine nucleotide-binding proteins (G proteins) form a large family of sigl-transducing molecules. They are found as heterotrimers made up of alpha, beta, and gamma subunits. Members of the G protein family have been characterized most extensively on the basis of the alpha subunit, which binds guanine nucleotide, is capable of hydrolyzing GTP, and interacts with specific receptor and effector molecules. The G protein family includes Gs and Gi, the stimulatory and inhibitory GTP-binding regulators of adenylate cyclase; Go, a protein abundant in brain (GO1); and transducin-1 (GT1) and transducin-2 (GT2), proteins involved in phototransduction in retil rods and cones, respectively.Guanine nucleotide-binding proteins (G proteins) form a large family of sigl-transducing molecules. They are found as heterotrimers made up of alpha, beta, and gamma subunits. Members of the G protein family have been characterized most extensively on the basis of the alpha subunit, which binds guanine nucleotide, is capable of hydrolyzing GTP, and interacts with specific receptor and effector molecules. The G protein family includes Gs (MIM 139320) and Gi, the stimulatory and inhibitory GTP-binding regulators of adenylate cyclase; Go, a protein abundant in brain (GO1; MIM 139311); and transducin-1 (GT1; MIM 139330) and transducin-2 (GT2; MIM 139340), proteins involved in phototransduction in retil rods and cones, respectively (Sullivan et al., 1986 [PubMed 3092218]; Bray et al., 1987 [PubMed 3110783]). Suki et al. (1987) [PubMed 2440724] concluded that the human genome contains at least 3 nollelic genes for alpha-i-type subunits of G protein; see, e.g, GI2 (MIM 139360), GI3 (MIM 139370), and GIH (MIM 139180).[supplied by OMIM]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordites used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for G protein alpha inhibitor 1 (5 products)

Catalog No. Species Pres. Purity   Source  

G protein alpha inhibitor 1

G protein alpha inhibitor 1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

G protein alpha inhibitor 1 (1-354, His-tag)

G protein alpha inhibitor 1 Human Purified > 90 % by SDS - PAGE E. coli
0.25 mg / €820.00
  OriGene Technologies GmbH

G protein alpha inhibitor 1 (1-354, His-tag)

G protein alpha inhibitor 1 Human Purified > 90 % by SDS - PAGE E. coli
50 µg / €320.00
  OriGene Technologies GmbH

G protein alpha inhibitor 1

G protein alpha inhibitor 1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

G protein alpha inhibitor 1

G protein alpha inhibitor 1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for G protein alpha inhibitor 1 (1 products)

Catalog No. Species Pres. Purity   Source  

GNAI1 overexpression lysate

GNAI1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn