TA335040 G protein alpha Q / GNAQ antibody

Rabbit Polyclonal Anti-GNAQ Antibody

See related secondary antibodies

Search for all "G protein alpha Q / GNAQ"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rat, Zebrafish G protein alpha Q / GNAQ

Product Description for G protein alpha Q / GNAQ

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rat, Zebrafish G protein alpha Q / GNAQ.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for G protein alpha Q / GNAQ

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GAQ, Guanine nucleotide-binding protein G(q) subunit alpha, Guanine nucleotide-binding protein alpha-q
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P50148
Immunogen:
The immunogen for anti-GNAQ antibody: synthetic peptide directed towards the N terminal of human GNAQ. Synthetic peptide located within the following region: DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK.
GeneID:
2776
Application WB
Background This locus encodes a guanine nucleotide-binding protein. The encoded protein, an alpha subunit in the Gq class, couples a seven-transmembrane domain receptor to activation of phospolipase C-beta. Mutations at this locus have been associated with problems in platelet activation and aggregation. A related pseudogene exists on chromosome 2.[provided by RefSeq, Nov 2010].
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for G protein alpha Q / GNAQ (7 products)

Catalog No. Species Pres. Purity   Source  

G protein alpha Q / GNAQ

G protein alpha Q / GNAQ Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

G protein alpha Q / GNAQ (1-359, His-tag)

G protein alpha Q / GNAQ Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

G protein alpha Q / GNAQ (1-359, His-tag)

G protein alpha Q / GNAQ Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

G protein alpha Q / GNAQ

G protein alpha Q / GNAQ Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

G protein alpha Q / GNAQ

G protein alpha Q / GNAQ Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

G protein alpha Q / GNAQ

G protein alpha Q / GNAQ Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

G protein alpha Q / GNAQ

G protein alpha Q / GNAQ Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for G protein alpha Q / GNAQ (3 products)

Catalog No. Species Pres. Purity   Source  

GNAQ 293T Cell Transient Overexpression Lysate(Denatured)

GNAQ 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

GNAQ 293T Cell Transient Overexpression Lysate(Denatured)

GNAQ 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

GNAQ Lysate

Western Blot: GNAQ Lysate [NBL1-11159] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for GNAQ
  Novus Biologicals Inc.
  • LinkedIn