TA335064 Alpha-amylase 1 / AMY1 antibody

Rabbit Polyclonal Anti-Amy1a Antibody

See related secondary antibodies

Search for all "Alpha-amylase 1 / AMY1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human, Mouse, Porcine, Rabbit, Rat Alpha-amylase 1 / AMY1

Product Description for Alpha-amylase 1 / AMY1

Rabbit anti Canine, Human, Mouse, Porcine, Rabbit, Rat Alpha-amylase 1 / AMY1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Alpha-amylase 1 / AMY1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 1, 4-alpha-D-glucan glucanohydrolase 1, AMY1A, Salivary alpha-amylase
Presentation Purified
Reactivity Can, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P00687
Immunogen:
The immunogen for anti-Amy1a antibody is: synthetic peptide directed towards the middle region of Rat Amy1a. Synthetic peptide located within the following region: YLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKMAV.
GeneID:
24203
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn