TA335066 Ferredoxin reductase antibody

Rabbit Polyclonal Anti-FDXR Antibody

See related secondary antibodies

Search for all "Ferredoxin reductase"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat Ferredoxin reductase

TA335066

More Views

  • TA335066

Product Description for Ferredoxin reductase

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat Ferredoxin reductase.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Ferredoxin reductase

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ADXR, Adrenodoxin reductase, FDXR, Ferredoxin-NADP(+) reductase, NADPH:adrenodoxin oxidoreductase
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P22570
Immunogen:
The immunogen for anti-FDXR antibody: synthetic peptide directed towards the middle region of human FDXR. Synthetic peptide located within the following region: LDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASASRAW.
GeneID:
2232
Application WB
Background FDXR is a mitochondrial flavoprotein that initiates electron transport for cytochromes P450 receiving electrons from DPH.This gene encodes a mitochondrial flavoprotein that initiates electron transport for cytochromes P450 receiving electrons from DPH. Multiple altertively spliced transcript variants of this gene have been described although the full-length ture of only two that encode different isoforms have been determined.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Ferredoxin reductase (6 products)

Catalog No. Species Pres. Purity   Source  

Ferredoxin reductase (transcript variant 1)

Ferredoxin reductase Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Ferredoxin reductase

Ferredoxin reductase Human
  Abnova Taiwan Corp.

Ferredoxin reductase

Ferredoxin reductase Human Purified
  Abnova Taiwan Corp.

Ferredoxin reductase

Ferredoxin reductase Human Purified
  Abnova Taiwan Corp.

Ferredoxin reductase

Ferredoxin reductase Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Ferredoxin reductase

Ferredoxin reductase Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Ferredoxin reductase (3 products)

Catalog No. Species Pres. Purity   Source  

FDXR 293T Cell Transient Overexpression Lysate(Denatured)

FDXR 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

FDXR 293T Cell Transient Overexpression Lysate(Denatured)

FDXR 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

Ferredoxin Reductase Lysate

Western Blot: Ferredoxin Reductase Lysate [NBL1-10672] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for FDXR
  Novus Biologicals Inc.
  • LinkedIn