TA335069 FGF14 antibody

Rabbit Polyclonal Anti-FGF14 Antibody

See related secondary antibodies

Search for all "FGF14"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Human, Mouse, Rabbit, Rat, Sheep FGF14

Product Description for FGF14

Rabbit anti Bovine, Equine, Human, Mouse, Rabbit, Rat, Sheep FGF14.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FGF14

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms FGF-14, FHF4, Fibroblast growth factor 14, Fibroblast growth factor homologous factor 4
Presentation Purified
Reactivity Bov, Eq, Hu, Ms, Rb, Rt, Sh
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q92915
Immunogen:
The immunogen for anti-FGF14 antibody: synthetic peptide directed towards the middle region of human FGF14. Synthetic peptide located within the following region: ENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKP.
GeneID:
2259
Application WB
Background The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. A mutation in this gene is associated with autosomal domint cerebral ataxia. Altertively spliced transcript variants have been found for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FGF14 (5 products)

Catalog No. Species Pres. Purity   Source  

FGF14 (transcript variant 1)

FGF14 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

FGF14 (1-247, His-tag)

FGF14 Human Purified > 90 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

FGF14 (1-247, His-tag)

FGF14 Human Purified > 90 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH

FGF14

FGF14 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

FGF14

FGF14 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for FGF14 (2 products)

Catalog No. Species Pres. Purity   Source  

FGF14 overexpression lysate

FGF14 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

FGF14 overexpression lysate

FGF14 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn