TA335074 ARHGAP1 antibody

Rabbit Polyclonal Anti-ARHGAP1 Antibody

See related secondary antibodies

Search for all "ARHGAP1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat ARHGAP1

Product Description for ARHGAP1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat ARHGAP1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ARHGAP1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CDC42 GTPase-activating protein, CDC42GAP, GTPase-activating protein rhoOGAP, RHOGAP1, Rho GTPase-activating protein 1, Rho-related small GTPase protein activator, Rho-type GTPase-activating protein 1, p50-RhoGAP
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q07960
Immunogen:
The immunogen for anti-ARHGAP1 antibody: synthetic peptide directed towards the N terminal of human ARHGAP1. Synthetic peptide located within the following region: MDPLSELQDDLTLDDTSEALNQLKLASIDEKNWPSDEMPDFPKSDDSKSS.
GeneID:
392
Application WB
Background ARHGAP1 is a GTPase activator for the Rho, Rac and Cdc42 proteins, converting them to the putatively ictive GDP-bound state. Cdc42 seems to be the preferred substrate.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ARHGAP1 (3 products)

Catalog No. Species Pres. Purity   Source  

ARHGAP1

ARHGAP1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ARHGAP1

ARHGAP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ARHGAP1

ARHGAP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ARHGAP1 (2 products)

Catalog No. Species Pres. Purity   Source  

ARHGAP1 Lysate

Western Blot: ARHGAP1 Lysate [NBL1-07665] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ARHGAP1 Protein
  Novus Biologicals Inc.

ARHGAP1 overexpression lysate

ARHGAP1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn