TA335098 LOXL1 antibody

Rabbit Polyclonal Anti-LOXL1 Antibody

See related secondary antibodies

Search for all "LOXL1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat LOXL1

Product Description for LOXL1

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat LOXL1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LOXL1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms LOL, LOXL, Lysyl oxidase homolog 1, Lysyl oxidase-like protein 1
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q08397
Immunogen:
The immunogen for anti-LOXL1 antibody: synthetic peptide directed towards the middle region of human LOXL1. Synthetic peptide located within the following region: YRPNQNGRGLPDLVPDPNYVQASTYVQRAHLYSLRCAAEEKCLASTAYAP.
GeneID:
4016
Application WB
Background LOXL1 is a member of the lysyl oxidase family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additiol roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additiol roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for LOXL1 (2 products)

Catalog No. Species Pres. Purity   Source  

LOXL1 293T Cell Transient Overexpression Lysate(Denatured)

LOXL1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

LOXL1 overexpression lysate

LOXL1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn