TA335116 TMED8 / FAM15B antibody

Rabbit polyclonal Anti-TMED8 Antibody

See related secondary antibodies

Search for all "TMED8 / FAM15B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine TMED8 / FAM15B

Product Description for TMED8 / FAM15B

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine TMED8 / FAM15B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TMED8 / FAM15B

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6PL24
Immunogen:
The immunogen for anti-TMED8 antibody: synthetic peptide directed towards the middle region of human TMED8. Synthetic peptide located within the following region: EIEEPVPAGDVERGSRSSLRGRYGEVMPVYRRDSHRDVQAGSHDYPGEGI.
GeneID:
283578
Application WB
Background The specific function of the protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TMED8 / FAM15B (1 products)

Catalog No. Species Pres. Purity   Source  

TMED8 / FAM15B

TMED8 / FAM15B Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for TMED8 / FAM15B (2 products)

Catalog No. Species Pres. Purity   Source  

TMED8 Lysate

Western Blot: TMED8 Lysate [NBL1-16985] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TMED8
  Novus Biologicals Inc.

TMED8 overexpression lysate

TMED8 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn