TA335118 ARMC8 antibody

Rabbit polyclonal Anti-ARMC8 Antibody

See related secondary antibodies

Search for all "ARMC8"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse ARMC8

Product Description for ARMC8

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse ARMC8.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ARMC8

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Armadillo repeat-containing protein 8, S863-2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IUR7
Immunogen:
The immunogen for anti-ARMC8 antibody: synthetic peptide directed towards the N terminal of human ARMC8. Synthetic peptide located within the following region: MEVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVP.
GeneID:
25852
Application WB
Background The function of ARMC8 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ARMC8 (7 products)

Catalog No. Species Pres. Purity   Source  

ARMC8 (transcript variant 1)

ARMC8 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ARMC8 (transcript variant 2)

ARMC8 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ARMC8 (transcript variant 3)

ARMC8 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ARMC8

ARMC8 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ARMC8

ARMC8 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ARMC8

ARMC8 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ARMC8

ARMC8 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ARMC8 (7 products)

Catalog No. Species Pres. Purity   Source  

ARMC8 293T Cell Transient Overexpression Lysate(Denatured)

ARMC8 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ARMC8 Lysate (Non-Denatured)

ARMC8 Lysate (Non-Denatured) Transient overexpression cell lysate was tested with Anti-ARMC8 antibody (H00025852-M01) by Western Blots.
  Abnova Taiwan Corp.

ARMC8 Lysate

Western Blot: ARMC8 Lysate [NBL1-07709] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ARMC8 Protein
  Novus Biologicals Inc.

ARMC8 Lysate

Western Blot: ARMC8 Lysate [NBL1-07710] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ARMC8 Protein
  Novus Biologicals Inc.

ARMC8 Lysate

Western Blot: ARMC8 Lysate [NBL1-07711] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ARMC8 Protein
  Novus Biologicals Inc.

ARMC8 overexpression lysate

ARMC8 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ARMC8 overexpression lysate

ARMC8 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn