TA335123 ARF4 antibody

Rabbit polyclonal Anti-Arf4 Antibody

See related secondary antibodies

Search for all "ARF4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Human, Mouse, Rat ARF4

Product Description for ARF4

Rabbit anti Bovine, Human, Mouse, Rat ARF4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ARF4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ADP-ribosylation factor 4, ARF2
Presentation Purified
Reactivity Bov, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P61750
Immunogen:
The immunogen for anti-Arf4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQD.
GeneID:
11843
Application WB
Background Arf4 is an GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. It is Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn