TA335127 SPNS2 antibody

Rabbit polyclonal Anti-SPNS2 Antibody

See related secondary antibodies

Search for all "SPNS2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Porcine, Rabbit, Rat SPNS2

Product Description for SPNS2

Rabbit anti Human, Mouse, Porcine, Rabbit, Rat SPNS2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SPNS2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Protein spinster homolog 2
Presentation Purified
Reactivity Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IVW8
Immunogen:
The immunogen for anti-SPNS2 antibody: synthetic peptide directed towards the N terminal of human SPNS2. Synthetic peptide located within the following region: PPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRY.
GeneID:
124976
Application WB
Background SPNS2 is the sphingolipid transporter required for migration of myocardial precursors. SPNS2 transports sphingosine 1-phosphate (S1P), a secreted lipid mediator that plays critical roles in cardiovascular, immunological, and neural development and function. SPNS2 mediates the export of S1P from cells in the extraembryonic yolk syncytial layer (YSL), thereby regulating myocardial precursor migration.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn