TA335136 NDP antibody

Rabbit polyclonal Anti-NDP Antibody

See related secondary antibodies

Search for all "NDP"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat NDP

TA335136

More Views

  • TA335136

Product Description for NDP

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat NDP.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for NDP

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms EVR2, Norrie disease protein, Norrin
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Por, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q00604
Immunogen:
The immunogen for anti-NDP antibody: synthetic peptide directed towards the middle region of human NDP. Synthetic peptide located within the following region: DPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTV.
GeneID:
4693
Application WB
IHC
Background This gene encodes a secreted protein with a cystein-knot motif that activates the Wnt/beta-catenin pathway. The protein forms disulfide-linked oligomers in the extracellular matrix. Mutations in this gene result in Norrie disease and X-linked exudative vitreoretinopathy. [provided by RefSeq, Feb 2009].
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NDP (6 products)

Catalog No. Species Pres. Purity   Source  

NDP (25-133, His-tag)

NDP Human Purified > 80 % by SDS - PAGE E. coli
0.25 mg / €820.00
  OriGene Technologies GmbH

NDP (25-133, His-tag)

NDP Human Purified > 80 % by SDS - PAGE E. coli
50 µg / €320.00
  OriGene Technologies GmbH

NDP

NDP Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NDP

NDP Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NDP

NDP Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NDP

NDP Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for NDP (3 products)

Catalog No. Species Pres. Purity   Source  

NDP 293T Cell Transient Overexpression Lysate(Denatured)

NDP 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

NDP Lysate

Western Blot: NDP Lysate [NBL1-13528] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for NDP.
  Novus Biologicals Inc.

NDP overexpression lysate

NDP overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn