TA335139 Peroxin 7 / PEX7 antibody

Rabbit polyclonal Anti-PEX7 Antibody

See related secondary antibodies

Search for all "Peroxin 7 / PEX7"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit Peroxin 7 / PEX7

Product Description for Peroxin 7 / PEX7

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit Peroxin 7 / PEX7.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Peroxin 7 / PEX7

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PTS2 receptor, PTS2R, Peroxin-7, Peroxisomal targeting signal 2 receptor
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O00628
Immunogen:
The immunogen for anti-PEX7 antibody: synthetic peptide directed towards the N terminal of human PEX7. Synthetic peptide located within the following region: MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLI.
GeneID:
5191
Application WB
Background PEX7 binds to the N-termil PTS2-type peroxisomal targeting sigl and plays an essential role in peroxisomal protein import.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Peroxin 7 / PEX7 (2 products)

Catalog No. Species Pres. Purity   Source  

Peroxin 7 / PEX7

Peroxin 7 / PEX7 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Peroxin 7 / PEX7

Peroxin 7 / PEX7 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn