TA335143 Protein S / PROS1 antibody

Rabbit polyclonal Anti-Pros1 Antibody

See related secondary antibodies

Search for all "Protein S / PROS1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat Protein S / PROS1

Product Description for Protein S / PROS1

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat Protein S / PROS1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Protein S / PROS1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PROS, Vitamin K-dependent protein S
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P53813
Immunogen:
The immunogen for anti-Pros1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LGGVPDISFSATPVNAFYSGCMEVNINGVQLDLDEAISKHNDIRAHSCPS.
GeneID:
81750
Application WB
Background Pros1 is a component of the Protein C/Protein S anticoagulant system; human homolog interacts with factor Xa, factor Va, and phospholipids to inhibit prothrombin activation.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn