TA335145 Peroxin 5 / PEX5 antibody

Rabbit polyclonal Anti-PEX5 Antibody

See related secondary antibodies

Search for all "Peroxin 5 / PEX5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse Peroxin 5 / PEX5

Product Description for Peroxin 5 / PEX5

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse Peroxin 5 / PEX5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Peroxin 5 / PEX5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PTS1 receptor, PTS1-BP, PTS1R, PXR1, Peroxin-5, Peroxisomal C-terminal targeting signal import receptor, Peroxisomal targeting signal 1 receptor, Peroxisome receptor 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P50542-3
Immunogen:
The immunogen for anti-PEX5 antibody: synthetic peptide directed towards the middle region of human PEX5. Synthetic peptide located within the following region: LNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLL.
GeneID:
5830
Application WB
Background PEX5 binds to the C-termil PTS1-type tripeptide peroxisomal targeting sigl (SKL-type) and plays an essential role in peroxisomal protein import. Peroxins (PEXs) are proteins that are essential for the assembly of functiol peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. The peroxisomal biogenesis disorders are a heterogeneous group with at least 14 complementation groups and with more than 1 phenotype being observed in cases falling into particular complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause of neotal adrenoleukodystrophy (LD), a cause of Zellweger syndrome (ZWS) as well as may be a cause of infantile Refsum disease (IRD).
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn