TA335149 PAFAH1B1 / LIS1 antibody

Rabbit polyclonal Anti-PAFAH1B1 Antibody

See related secondary antibodies

Search for all "PAFAH1B1 / LIS1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit PAFAH1B1 / LIS1

Product Description for PAFAH1B1 / LIS1

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit PAFAH1B1 / LIS1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PAFAH1B1 / LIS1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms LIS-1, Lissencephaly-1 protein, MDCR, MDS, PAF acetylhydrolase 45 kDa subunit, PAF-AH alpha, PAFAH alpha, PAFAHA, Platelet-activating factor acetylhydrolase IB subunit alpha
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P43034
Immunogen:
The immunogen for anti-PAFAH1B1 antibody: synthetic peptide directed towards the N terminal of human PAFAH1B1. Synthetic peptide located within the following region: KLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVF.
GeneID:
5048
Application WB
Background This locus was identified as encoding a gene that when mutated or lost caused the lissencephaly associated with Miller-Dieker lissencephaly syndrome. PAFAH1B1 is the non-catalytic alpha subunit of the intracellular Ib isoform of platelet-activating factor acteylhydrolase, a heterotrimeric enzyme that specifically catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine). Two other isoforms of intracellular platelet-activating factor acetylhydrolase exist: one composed of multiple subunits, the other, a single subunit. In addition, a single-subunit isoform of this enzyme is found in serum.PAFAH1B1 was identified as encoding a gene that when mutated or lost caused the lissencephaly associated with Miller-Dieker lissencephaly syndrome. PAFAH1B1 encodes the non-catalytic alpha subunit of the intracellular Ib isoform of platelet-activating factor acteylhydrolase, a heterotrimeric enzyme that specifically catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine). Two other isoforms of intracellular platelet-activating factor acetylhydrolase exist: one composed of multiple subunits, the other, a single subunit. In addition, a single-subunit isoform of this enzyme is found in serum. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordites used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PAFAH1B1 / LIS1 (5 products)

Catalog No. Species Pres. Purity   Source  

PAFAH1B1 / LIS1

PAFAH1B1 / LIS1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PAFAH1B1 / LIS1

PAFAH1B1 / LIS1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PAFAH1B1 / LIS1

PAFAH1B1 / LIS1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PAFAH1B1 / LIS1

PAFAH1B1 / LIS1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PAFAH1B1 / LIS1

PAFAH1B1 / LIS1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn