TA335150 Mevalonate kinase antibody

Rabbit polyclonal Anti-MVK Antibody

See related secondary antibodies

Search for all "Mevalonate kinase"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit Mevalonate kinase

Product Description for Mevalonate kinase

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit Mevalonate kinase.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Mevalonate kinase

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms MK, MVK
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q03426
Immunogen:
The immunogen for anti-MVK antibody: synthetic peptide directed towards the N terminal of human MVK. Synthetic peptide located within the following region: LAVLAFLYLYLSICRKQRALPSLDIVVWSELPPGAGLGSSAAYSVCLAAA.
GeneID:
4598
Application WB
Background MVK is the peroxisomal enzyme mevalote kise. Mevalote is a key intermediate, and mevalote kise a key early enzyme, in isoprenoid and sterol synthesis. Mevalote kise deficiency caused by mutation of this gene results in mevalonic aciduria, a disease characterized psychomotor retardation, failure to thrive, hepatosplenomegaly, anemia and recurrent febrile crises. Defects in this gene also cause hyperimmunoglobuliemia D and periodic fever syndrome, a disorder characterized by recurrent episodes of fever associated with lymphadenopathy, arthralgia, gastrointestil dismay and skin rash.This gene encodes the peroxisomal enzyme mevalote kise. Mevalote is a key intermediate, and mevalote kise a key early enzyme, in isoprenoid and sterol synthesis. Mevalote kise deficiency caused by mutation of this gene results in mevalonic aciduria, a disease characterized psychomotor retardation, failure to thrive, hepatosplenomegaly, anemia and recurrent febrile crises. Defects in this gene also cause hyperimmunoglobuliemia D and periodic fever syndrome, a disorder characterized by recurrent episodes of fever associated with lymphadenopathy, arthralgia, gastrointestil dismay and skin rash. Two transcript variants that encode the same protein have been found for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Mevalonate kinase (9 products)

Catalog No. Species Pres. Purity   Source  

Mevalonate kinase (transcript variant 1)

Mevalonate kinase Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Mevalonate kinase (transcript variant 2)

Mevalonate kinase Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Mevalonate kinase (1-396, His-tag)

Mevalonate kinase Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

Mevalonate kinase (1-396, His-tag)

Mevalonate kinase Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

Mevalonate kinase

Mevalonate kinase Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Mevalonate kinase

Mevalonate kinase Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Mevalonate kinase

Mevalonate kinase Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Mevalonate kinase

Mevalonate kinase Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Mevalonate kinase

Mevalonate kinase Human
  Abnova Taiwan Corp.

Positive controls for Mevalonate kinase (2 products)

Catalog No. Species Pres. Purity   Source  

MVK 293T Cell Transient Overexpression Lysate(Denatured)

MVK 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

MVK Lysate

Western Blot: MVK Lysate [NBL1-13401] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for MVK.
  Novus Biologicals Inc.
  • LinkedIn