TA335153 PCCB antibody

Rabbit polyclonal Anti-PCCB Antibody

See related secondary antibodies

Search for all "PCCB"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat PCCB

Product Description for PCCB

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat PCCB.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PCCB

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PCCase subunit beta, Propanoyl-CoA:carbon dioxide ligase subunit beta, Propionyl-CoA carboxylase beta chain mitochondrial
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P05166
Immunogen:
The immunogen for anti-PCCB antibody: synthetic peptide directed towards the middle region of human PCCB. Synthetic peptide located within the following region: PGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVITRKAYGGAYDVMSS.
GeneID:
5096
Application WB
Background PCCB is a subunit of the propionyl-CoA carboxylase (PCC) enzyme, which is involved in the catabolism of propionyl-CoA. PCC is a mitochondrial enzyme that probably acts as a dodecamer of six alpha subunits and six beta subunits. Defects in this gene are a cause of propionic acidemia type II (PA-2).
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PCCB (3 products)

Catalog No. Species Pres. Purity   Source  

PCCB

PCCB Human
  Abnova Taiwan Corp.

PCCB

PCCB Human Purified
  Abnova Taiwan Corp.

PCCB

PCCB Human Purified
  Abnova Taiwan Corp.

Positive controls for PCCB (2 products)

Catalog No. Species Pres. Purity   Source  

PCCB 293T Cell Transient Overexpression Lysate(Denatured)

PCCB 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PCCB overexpression lysate

PCCB overexpression lysate
  OriGene Technologies, Inc.
  • LinkedIn